<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1100 1100-30305 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A L33F L10I, I13V, R41K, K43I, I62V, L63P, H69Y, A71V, I72IT, V77I, I93L  
>1100-30305| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGKWIPKLIVGIGGFSKVRQYDQVP
IEICGYKVTGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   Y188L   K43Q, D123E, R172K, D177G, V179I, I202V, R211K, H221HY  
>1100-30305| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPGIIIYQYVDDLLVGSDLEIGQHRTKVEELRQHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006