<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1094 1094-40614 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54A, V82T, L90M L33F L10S, I13V, E35D, M36I, N37Q, R41P, I62V, L63P, I64V, A71V, T74S, I93L  
>1094-40614| codons 1-99
PQITLWQRPSVTVKIGGQLKEALLDTGADDTVFEDIQLPGPWKPKLIGGIGGFAKVRQYD
QVPVEICGHKVIGSVLVGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y   K101P   V111I, V118I, I142T, T200A, H208Y, R211K, L228H, A272S, A288S, S322T, I329L, N348T, M357T, A360V, E399D, A400T  
>1094-40614| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKTLKTGKYARTRGV
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWDT

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006