<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1369 1369-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V   L10I, T12S, I13V, I15IV, Q18H, K20T, M36I, N37D, I62V, L63P, A71V P79PHSY
>1369-30717| codons 4-99
TLWQRPIVSVKVGGHLTEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVIGTVLVGYTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R V75AT, K219E K103N, Y181C   V60I, K64KR, V106VI, K122E, I135T, I178M, E203K, Q207E  
>1369-30717| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIRKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVGSDLEIGQHRTKIKELREHLLRWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006