<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1368 1368-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, L33F, G73S E34Q, K55R, R57K, I62V, L63P, C67W, A71T, I72T, V77I, P79D, I93L  
>1368-30630| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVFQEMNLPGRWKPKIIGGIGGFMRVKQYDQVP
IEIWGHKTTSTVLIGDTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y K219R Y181C, G190A V108I K43M, K101Q, V118I, K122E, I135V, I142V, S162C, E194D, D218E, H221Y, L228R, V245Q  
>1368-30630| codons 38-247
CTELEMEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYMDDLYVASDLDIGQHRTKIEELRQHLWRWGFYTP
ERKYQKEPPFRWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006