<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1362 1362-30616 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, I84V, L90M L10F, L33F, L89V I13V, I15V, K20R, E35D, M36I, K43Q, R57K, D60E, L63P, A71V, P79A R8Q
>1362-30616| codons 4-99
TLWQQPFVTVKVGGQLREALLDTGADDTIFEDINLPGRWQPKIVGGIGGFVKVKQYEQIP
IEICGHKVIGTVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y K219R     K43N, E44D, K49R, V106I, V118I, K122E, S162D, I178M, Q197E, E203K, H208Y, R211K, K223E, L228R  
>1362-30616| codons 38-247
CTELENDGKISRIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGEHRTKIKELRQYLWKWGFYTP
DRKHQEEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006