<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1360 1360-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y188L   T39A, K43E, E44ED, V60I, V106I, V118I, D123E, I135T, S162A, D177E, V179I, D192H, T200V  
>1360-30813| codons 38-247
CAELEEDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPEIIIYQYVDDLLVGSHLEIGQHRVKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46L, I54V, I84V L33F, T74P L10IV, T12TP, I13V, I15V, K20R, E35ED, M36I, R41K, I62V, L63P, I64V, A71AV  
>1360-30813| codons 4-99
TLWQRPVVPVKVGGQLREALLDTGADDTIFEDINLPGKWKPKLIGGIGGFVKVRQYDQVP
VEICGHKVIGPVLVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006