<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1358 1358-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54V, V82A L33F, K43T L10V, I13IV, L19I, L63LP, I64IV, T74S, V77I, L89LI, T91S  
>1358-30625| codons 4-99
TLWQRPVVTVKIGGQIKEALLDTGADDTVFEEMNLPGRWTPKMIVGVGGFVKVRQYDQIP
VEICGHKAIGSVLIGPTPANIIGRNILSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74V, L210W T215C, K219R K101E, Y181C, G190A V108I K43N, E44D, K49R, V118I, K122E, I135T, G196GV, R211K, F214L, K223Q, L228R, V245R  
>1358-30625| codons 38-247
CTELENDGKISRIGPENPYNTPVFAIKKKDSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIVQHRTKIEELRQHLWKWGLCTP
DRKHQQEPPFRWMGYELHPDKWTVQPIRLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006