<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1356 1356-30530 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10F, L24I, L33F I13V, L19I, K20T, M36L, K55KR, I62V, L63P, K70KR, A71V  
>1356-30530| codons 4-99
TLWQRPFVTVKIGGQITEALIDTGADDTVFEELNLPGRWKPKLIGGIGGFVRVRQYDQVP
IEICGHRVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K101E, Y181C, G190A   K43Q, E44D, K64KR, K103KR, V118I, K122E, S162C, R211K, D218E  
>1356-30530| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKRKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006