<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1355 1355-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A V11I, L24I, L33F, F53L, G73S L10I, I13IV, I15V, G16E, M36ML, N37S, K55R, I62V, L63C, A71V  
>1355-30527| codons 4-99
TLWQRPIITVKVEGQLKEALIDTGADDTVFEELSLPGRWKPKLIGGIGGLVRVRQYDQVC
IEICGHKVISTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q   V179D T39A, K64H, T69N, K103R, E138Q, S162C, G196E, T200A, E203K, Q207E, R211I, V245K  
>1355-30527| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIEQHRAKIKELREHLLIWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006