<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1353 1353-30711 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L23I, L33F, Q58E L10I, I13V, L19I, L24M, M36ML, N37D, K55R, I62V, L63P, H69Y, A71T, I72T, V75I  
>1353-30711| codons 4-99
TLWQRPIVTVKIGGQIKEAIMDTGADDTVFEELDLPGRWKPKLIGGIGGFVRVREYDQVP
IEICGYKTTGTILVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, Q151M V75I, F77L, F116Y G190A V179D S68G, V90I, K103R, V106L, V118I, I135L, E138Q, T165I, R172K, F214L  
>1353-30711| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKRKDGTKWRKLIDLRELNKRTQDFWEIQLGIPHP
AGLKKRKSLTVLDVGDAYYSIPLDKDFRKYTAFTIPSLNNQTPGIRYQYNVLPMGWKGSP
AIFQSSMIKILEPFKKQNPDIDIYQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006