<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1349 1349-30602 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y K219KN L100I, Y188L   V90VI, V118I, K122E, D123N, I135T, V189VI, T200A, H208F, R211K, L228H  
>1349-30602| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGIKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLLIGSDLEIGQHRAKIEELRQFLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M K43T, G73S L10I, T12E, L19I, K20R, E35D, M36I, K55R, R57K, Q61QR, I62V, L63P, A71V, I72IR, I85V  
>1349-30602| codons 4-99
TLWQRPIVEIKIGGQIREALLDTGADDTVLEDINLPGRWTPKIIGGIGGFVRVKQYDRVP
IEICGHKVRSTVLVGPTPTNIVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006