<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1352 1352-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, V11I, Q58E, L89V I13V, K20I, M36I, N37D, K55KR, I62V, L63P, H69Q, A71T, Q92K T91CS
>1352-30519| codons 4-99
TLWQRPFITVKIGGQLIEALLDTGADDTVLEEIDLPGRWKPKIVGGIGGFVRVREYDQVP
IEICGQKTIGTVLVGPTPVNVIGRNVMSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, M184V, L210W, T215Y   K103N K238KT S68G, D121H, K122E, R172RK, Q174K, D177E, I178L, R211RK, V245T  
>1352-30519| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKKNPELVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDTWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006