<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1351 1351-30516 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, L90M L10F, F53L I13V, K14R, I15V, K20R, E35D, M36ML, N37T, R41K, I62V, L63P, H69K, A71V, V77I  
>1351-30516| codons 4-99
TLWQRPFVTVRVGGQLREALLDTGADDTILEDLTLPGKWKPKIVGGIGGLLKVRQYDQVP
IEICGKKVIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70G, T215F K219Q Y188L   T39TA, V60I, K122E, I135T, I142L, K166R, G196GRS, H208Y, D218E, V245K  
>1351-30516| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTGWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYMDDLLVGSDLEISQHRTKIEELRQYLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006