<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2169 2169-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L10F I13V, K20KR, L63P, I64V, K70R  
>2169-30813| codons 4-99
TLWQRPFVTVKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIP
VEICGHRAIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L210W, T215Y K219E   A98AG, V108VI K122E, K126E, S134R, I135T, I178L, T200A, H208HY, R211RK, D218DE, V245E K49T, K82Q, N137T
>2169-30813| codons 38-247
CTEMEKEGKISTIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNQRTQDFWEVQLGIPHP
GGLKKKKSVTILDVGDAYFSVPLDEDFREYTAFTIPRTNTETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTP
EEKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006