<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2167 2167-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I50L L10LF, V11VI, L33I, N88D I13V, E35D, M36I, K45KI, R57K, L63P, A71T  
>2167-30702| codons 4-99
TLWQRPFITVKIGGQLKEALLDTGADNTVIEDINLPGRWKPIMIGGLGGFIKVKQYDQIP
IEICGHKTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_XG, L74I, M184MV, T215Y D67G K103N V108I, P225H R83K, K102Q, D123E, I135T, S162Y, I178ILM, T200A  
>2167-30702| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGSSKWRKIVDFRELNKKTQDFWEVQLGIPHP
AGLKQNKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006