<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1282 1282-30424 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33LF, G73T I62V, L63P, V77VI  
>1282-30424| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKAITTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q K103N   T39A, V60I, K122E, D123N, D177EG, T200TA, H208Y, R211K, D218E, L228H, V245E  
>1282-30424| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYMDDLYVGSDLEIGQHRAKIEELRQYLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006