<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1277 1277-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y K219R K101E, Y181C, G190A V108I T39A, K43E, W88S, K102Q, D123E, I142V, V189I, Q197K, H221Y, L228R  
>1277-30417| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFSEVQLGIPHP
AGLEQKKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYIASDLEIGKHRTKIEELRQHLWRWGFYTP
DRKYQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M   L10V, E34Q, M36MI, N37S, I62V, L63T, H69Q, K70Q, A71V, I72T, Q92K, I93L  
>1277-30417| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTILQEISLPGRWKPKIVGGIGGFLKVRQYDQVT
IEICGQQVTGTVLVGPTPVNVIGRNLMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006