<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2185 2185-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A   L10I, I15V, G16A, K20R, E35D, M36I, N37D, K55R, R57K, I62V, L63P, A71V, I93L  
>2185-30822| codons 4-99
TLWQRPIVTIKVAGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVRVKQYDQVP
IEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y       E44D, V118I, I135T, K173E, Q174K, D177E, Q197E, I202V, Q207EK, H208Y, R211K, H221C, V245K K43KHNQ
>2185-30822| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFREKNPEIVIYQYVDDLYVGSDLEIGEHRTKVEELRKYLWKWGFYTP
DKKCQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006