<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2182 2182-30627 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82A, L90M V11I, F53FL, G73S L10I, I15V, Q18H, K20I, M36I, N37D, K55R, L63P, A71V, I72IV, I85V  
>2182-30627| codons 4-99
TLWQRPIITIKVGGHLIEALLDTGADDTVLEEIDLPGRWKPKIVGGIGGLVRVRQYDQIP
IEICGHKVVSTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, Y181C   K122E, I135T, I142T, E169D, V179VI, T200A, I202V, V245M  
>2182-30627| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIIICQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006