<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1447 1447-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, V75M, L210LW F77L, T215DHLV K101E, G190A   K43E, E44A, K82KR, R83K, V106VI, V118I, K122P, S163SC, I178L, V179VI, G196EK, Q207E  
>1447-30515| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDLRELNRKTQDFWEVQLGIPHP
AGLEKKKSITVLDVGDAYFSIPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSCMTKILEPFRKQNPDLIIYQYMDDLYVASDLEIKQHRTKIEELREHLWRWGFVTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82A, I84V, L90M   L10I, F53FY, I62IV, L63HP, I64IM, A71V, V77I, I93L  
>1447-30515| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGYIKVRQYDQVP
MEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006