<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1446 1446-30514 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, L74V, M184V, T215Y A62V Y181C, G190S K101H K122E, D177E, T200TA, L228H N57NH
>1446-30514| codons 38-247
CTEMEKEGKISKIGPENPYHTPVFVIKKKDSSKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MIL, I47IV, I54IMV, V82A, L90M L33LF, K43T L10I, L19I, K20R, E35D, M36I, L63P, I64V, I66IF, K70KR, A71V  
>1446-30514| codons 4-99
TLWQRPIVTIKIGGQIREALLDTGADDTIFEDINLPGRWTPKLVGGIGGFVKVRQYDQIP
VEFCGHRVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006