<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1445 1445-30513 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L10F, V11VI, L33F, L89LV I13V, K20T, E34EQ, E35DN, M36I, R41K, D60E, I62V, L63P, A71V, I72IM, P79H  
>1445-30513| codons 4-99
TLWQRPFITVKIGGQLTEALLDTGADDTVFQNINLPGKWKPKMIGGIGGFLKVRQYEQVP
IEICGHKVMGTVLVGHTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75T, K219D K103N L234I K43E, K64R, V118I, K122KE, D123DE, G196E, T200A, E203K, Q207E, D218E, F227Y, L228H  
>1445-30513| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIRKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIKELREHLWRWGFYTP
EDKHQKEPPYHWMGYEIHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006