<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1347 1347-30505 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115YF, M184V, L210W, T215Y K219E Y181C   K101KQ, K122E, S162C, E169D, Q174QR, Q197E, E203EK, Q207E, R211K, L228H  
>1347-30505| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKRNPDIVICQYVDDLYVGSDLEIGEHRTKIKELREHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M V11I, L33LF, G73S, L89LV L10I, I13V, I15IV, K20T, I62V, L63P, A71V, I72L, P79AS  
>1347-30505| codons 4-99
TLWQRPIITVKVGGQLTEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKVLSTVLVGSTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006