<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2349 2349-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A L10F, K43T I15V, K20R, M36I, Q61E, I62V, L63P, K70T, A71V, I93L  
>2349-30821| codons 4-99
TLWQRPFVTIKVGGQLREALLDTGADDTVLEEINLPGRWTPKLIGGIGGFVKVRQYDEVP
IEICGHTVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, L210W, T215Y K219R   V108I E44D, V60I, V118I, K122E, I135M, T139TA, L193F, T200A, Q207AE, H208Y, R211K, H221Y  
>2349-30821| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSMNNEAPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDFEIGQHRAKIEELREYLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006