<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2348 2348-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E L100I, K103N   T39A, V60I, V90I, A98S, D121Y, K122E, I135T, S162Y, I202V, E203ED, V245K  
>2348-30820| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHP
SGIKKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVDELRQHLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M V11VI, G73S L10I, I15V, G16GA, L19LI, E35D, N37H, R41K, K45R, L63P, A71V, I72L, C95L  
>2348-30820| codons 4-99
TLWQRPIITIKVAGQIKEALLDTGADDTVLEDMHLPGKWKPRIIGGIGGFVKVRQYDQIP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGLTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006