<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2347 2347-30806 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, I84V, L90M L33F, T74P L10I, I13V, E35D, N37P, R41K, I62V, L63LP, A71V, V77I, I93L  
>2347-30806| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEDMPLPGKWKPKIIGGIGGFLKVRQYDQVP
IEICGHKVIGPVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, L210W, T215Y   K101E, Y181C, G190S   T39A, E44D, V106I, V118I, K122E, I135T, K166R, V189I, I195IT, G196E, E203K, Q207E, H208Y, R211K, K223E  
>2347-30806| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYMDDLYISSDLETEQHRTKIKELREYLWKWGFYTP
DKKHQEEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006