<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1969 1969-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, V32I, M46I, I47V, I54L, I84V, L90M L10F, L33F, F53L, N88D I13V, E34Q, I62V, L63C, T74E, V77I, P79A, L89M  
>1969-30626| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADNTIFQEMNLPGRWKPKIVGGIGGLLKVRQYDQVC
IEICGHKAIGEVLIGATPVNVIGRDMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E K103N   T39A, V60I, V118VI, K122E, I135IT, S162SY, T200A, H208Y, R211K, L228LH, V245E D177DGNS
>1969-30626| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPSIVIYQYVDDLYVGSDLEIGQHRAKIEELRQYLLKWGFFTP
DEKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006