<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1968 1968-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54IM, L76V, L90LM G73S, L89LV L10I, I13V, L19I, I62IV, L63P, A71V, V77I, I93L  
>1968-30625| codons 4-99
TLWQRPIVTVKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIVGGIGGFMKVRQYDQVP
IEICGHKVISTVVIGPTPVNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, L210W, T215Y K219E     E44ED, V118VI, K122E, D123N, S162C, D177E, G196E, E203V, Q207E, H208Y, R211K, K223KT, L228H  
>1968-30625| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKIVELREYLWKWGFYTP
DEKHQTEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006