<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1342 1342-30423 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   L100I, K103N   V60I, V118VI, K122E, D177E, I178M, T200A, Q207E, E224D  
>1342-30423| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, L33F, K43T, T74P I13V, E34Q, M36MI, L63T, A71V, I72V, T91S, I93L  
>1342-30423| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVFQEINLPGRWTPKLIGGIGGFVKVRQYDQIT
IEICGHKVVGPVLVGPTPVNVIGRNLMSQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006