<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1338 1338-30414 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, E35D, M36I, N37S, R41K, L63P, C67E, A71T  
>1338-30414| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADNTVLEDISLPGKWKPKMIGGIGGFIKVRQYDQIP
IEIEGHKTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, T215Y       K102Q, D121Y, K122E, D123E, I135IMV, I142V, S162W, K173KE, D177E, T200I, E203ED, L228LR R206RS
>1338-30414| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLYEEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQWSMTKILEPFREQNPEIVIYQYMDDLYVGSDLEIGQHRIKIDELSQHLLRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006