<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2197 2197-30703 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, I84V, L90M L33F, Q58E, L89LV L10V, I13V, K20MR, E35D, M36I, N37ND, I62IV, L63P, A71T, I72V, Q92QK, I93L  
>2197-30703| codons 4-99
TLWQRPVVTVKIGGQLREALLDTGADDTVFEDIDLPGRWKPKLIGGIGGFVKVREYDQVP
IEICGHKTVGTVLVGPTPANVIGRNVMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215Y K219H K103N V108I K49KR, V60I, K102R, K122E, D123N, I135T, T200A, L228H  
>2197-30703| codons 38-247
CTELEKEGKISRIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTILDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DHKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006