<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2196 2196-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82S   L10V, I15V, G16GE, K20R, E35D, M36I, N37S, P39PS, R41K, R57K, I62V, L63C, A71V, I72V, T74S, V77I, I93L  
>2196-30630| codons 4-99
TLWQRPVVTIKVEGQLREALLDTGADDTVLEDISLSGKWKPKIIVGIGGFTKVKQYDQVC
IEICGHKVVGSVLIGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y       T39TA, K43E, E44A, D123E, I135T, I167V, D177E, G196E, E204Q, D218E W212L
>2196-30630| codons 38-247
CAELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKIEQLRQHLLRLGFYTP
EKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006