<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2107 2107-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, N88S L10F, Q58E I13V, M36MI, N37E, I62IV, L63S, V77I, L89M, I93L  
>2107-30626| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVLEEIELPGRWKPKIIGGIGGFLKVREYDQVS
IEICGHKAIGTVLIGPTPVNIIGRSMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y D67G, K70KN, V75M K103KN   T39E, W88C, V118VI, K122E, F171Y, F214L, V245E N54I
>2107-30626| codons 38-247
CEELEKEGKISKIGPEIPYNTPVFAIKKKGSTNWRKLMDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPYRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006