<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1982 1982-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48LV, I54V, V82A, L90M F53FL L10V, K20R, M36I, R41K, K43KR, R57K, I62V, L63P, A71V, I72V, T74S, I93L  
>1982-30610| codons 4-99
TLWQRPVVTIKIGGQLREALLDTGADDTVLEEINLPGKWRPKMIVGIGGLVKVKQYDQVP
IEICGHKVVGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74V, Y115F, M184V K70KHNQ K103N, Y181C   S105T, K122E, D192N, Q197E, R211AG, H221Y  
>1982-30610| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTQWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKTVTVLDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSNLEIGEHRTKIEELRQHLLGWGFTTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006