<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1980 1980-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, G73T, L89V I13V, I15V, K20T, E34K, G51A, L63P, I64V, A71V, V77I, I93L  
>1980-30515| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADDTVLKEMNLPGRWKPKIIGGIAGFMKVRQYDQIP
VEICGHKVITTVLIGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C, G190S K101H K43X, E44D, V118I, K122E, S162C, F171Y, D177E, I178L, E203EK, H208Y, R211K, K223E, L228H  
>1980-30515| codons 38-247
CTELEXDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPYRKQNPELVICQYMDDLYVSSDLEIGQHRTKIKELRQYLWKWGFYTP
DNKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006