<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1932 1932-30513 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219KR K103N A98G K43N, E53D, V118VI, K122E, D123N, I142T, T200L, H208Y  
>1932-30513| codons 38-247
CTELENEGKISKIGPDNPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRLKIEELRQYLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, L33F, Q58QE, T74P I13V, K14R, E35D, M36I, I62V, L63P, I64V, Q92K  
>1932-30513| codons 4-99
TLWQRPFVTVRIGGQLKEALLDTGADDTVFEDINLPGRWKPKLIGGIGGFVKVREYDQVP
VEICGHKAIGPVLVGPTPVNVIGRNLMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006