<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1930 1930-30507 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82A L24I, L33LF L10I, T12P, I13IV, K14R, K20R, E35D, M36I, N37E, K55KR, R57K, L63P, A71T, T74S, V77VI, I93L  
>1930-30507| codons 4-99
TLWQRPIVPVRIGGQLREALIDTGADDTVFEDIELPGRWKPKIIGGIGGFVRVKQYDQIP
IEICGHKTIGSVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70R, M184V, T215F D67G, T69G, K219E G190A   K43EQ, V60VI, A98S, K101Q, K122E, I135L, S162C, D177DG, V179I  
>1930-30507| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKGSGRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPGIIIYQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006