<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1084 1084-30430 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M V11VI, G73T L10I, K20I, L63P, I64V, A71V, I72L, P79A  
>1084-30430| codons 4-99
TLWQRPIITIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
VEICGHKVLTTVLVGATPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181C, G190A A98G, V179F T39TA, K43N, E44D, V118VI, K122E, I142T, E169D, H208Y, R211RK, L228H, V245T  
>1084-30430| codons 38-247
CAELENDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIFICQYVDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006