<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1082 1082-30328 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       E44ED, A98S, K122E, I135L, E138A, G196E, E203ED, H208Y, R211RK, V245Q  
>1082-30328| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIDELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84V, L90M G73S, L89V L10I, V11L, I13V, Q18H, K20V, M36I, N37D, L63P, A71V  
>1082-30328| codons 4-99
TLWQRPILTVKIGGHLVEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYDQIP
IEICGHKVISTVLVGPTPTNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006