<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1081 1081-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V N83D L10I, I13V, G16A, K20R, A22V, E35D, M36I, I62V, L63P, A71T  
>1081-30417| codons 4-99
TLWQRPIVTVKIAGQLREVLLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYDQVP
IEICGHKTIGTVLVGPTPVDVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, Y115F, M184V V75I     K122E, D177DE, I178IM, V179VI, R211K  
>1081-30417| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006