<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2315 2315-30806 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M V11I, L33F, F53L, G73S T4S, L10V, I13V, I15V, L19LI, E34Q, M36L, L38W, K55KR, I62V, L63P, A71V  
>2315-30806| codons 4-99
SLWQRPVITVKVGGQIKEALLDTGADDTVFQELNWPGRWKPKMIGGIGGLVRVRQYDQVP
IEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L210W, T215Y K219E K103N, Y181C K101H S68G, L109LI, D123E, S162C, K173KQ, R211K, D218E, Q242K  
>2315-30806| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKNKSVTVIDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRQQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
EEKHQKEPPFLWMGYELHPDKWTVKPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006