<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2291 2291-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76LV, I84V, L90M L33F, G73GC, L89AV L10I, I13V, N37D, R57K, L63P, I66V, A71V, V77I K20AITV
>2291-30819| codons 4-99
TLWQRPIVTVKIGGQLVEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFMKVKQYDQIP
IEVCGHKVICTVVIGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219R   A98G T39A, K43E, R83K, I142V, G196E, H208F, R211K, D218E, V245E  
>2291-30819| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQFLWKWGFYTP
ERKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006