<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2093 2093-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L10F, L24I, L33F I13V, M36I, I62V, L63P, L89M  
>2093-30814| codons 4-99
TLWQRPFVTVKIGGQLKEALIDTGADDTVFEEINLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKAIGTVVVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y L100LI, K103N   S68G, T69I, K104R, K122E, E169D, R172K, Q174K, Q197E, T200A, R211K, F214L W88L
>2093-30814| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGIRWRKLIDLRELNKRTQDFLEVQLGIPHP
AGIKKNRSVTVLDVGDAYYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILDPFKKKNPDIVIYQYMDDLYVGSDLEIGEHRAKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006