<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2092 2092-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Y115F, Q151M A62V, K70S, V75I, F77L, F116Y, T215I, K219Q K101E, G190S Y188YF T58N, D123E, I135M, I167V, V179VI, T200I, R211K  
>2092-30724| codons 38-247
CTEMEKEGKISKIGPENPYNNPVFVIKKKNSTSWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAFYSVPLDKEFRKYTAFTIPSMNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKVLEPFRKQNPDIIIYQYMDDLFVSSDLEIGQHRIKIEELRQHLLKWGFITP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, V82C, I84V, L90M L10F, L33F, N88D T12S, I13V, K45R, Q61QH, I62V, L63P, I66V, A71T, I72T, P79X, Q92R, I93L, C95F  
>2092-30724| codons 4-99
TLWQRPFVSVKIGGQLKEALLDTGADNTVFEEMNLPGRWKPRMIGGIGGFVKVRQYDHVP
IEVCGHKTTGTVLVGXTPCNVIGRDLMTRLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006