<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2090 2090-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, I84V L89V L10I, I13V, Q18H, L19I, K20T, E21Q, E35D, M36I, N37D, R57RK, L63P, A71I, Q92K, I93L  
>2090-30630| codons 4-99
TLWQRPIVTVKIGGHITQALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFLKVKQYDQIP
IEICGHKIIGTVVVGPTPVNVIGRNVLTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y188L   K43E, K64R, V106I, K122E, D123N, S162C, I178L, V179I, T200A, E224D, V245T  
>2090-30630| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDLIIYQYVDDLLVGSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006