<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1973 1973-30619 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, V82T, I84V V11VI, L33F, K43T, M46V, F53L L10I, I13IV, I15V, K20R, E35D, M36V, N37NS, R41RK, L63P, I66F, A71V T80TS
>1973-30619| codons 4-99
TLWQRPIITVKVGGQLREALLDTGADDTIFEDVSLPGKWTPKVIGGIGGLVKVRQYDQIP
IEFCGHKVIGTVLVGPSPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y       T39TA, K43E, V118I, K122KE, I135L, Q174QK, T200TI, E203ED, Q207E, H208HY, R211K, L228H  
>1973-30619| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVIYQYMDDLYVGSDLEIGQHRIKIDELREYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006