<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1972 1972-30618 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I, L33F, Q58E T12Q, K55R, R57K, I62V, L63P, I64V, H69K, V77I  
>1972-30618| codons 4-99
TLWQRPFVQIKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVKEYDQVP
VEICGKKAIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, V75T, M184V, T215F K219E L100I, K103N   V60I, T69N, V90I, I135L, S162A, V179VI, G196E, L228H A98*S
>1972-30618| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKITDFRELNKRTQDFWEIQLGIPHP
SGIKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006