<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1971 1971-30605 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, G48V, I54M, V82A, I84IV, L90LM   L10I, I13V, N37ND, L63P, A71IV, I72V, V77VI  
>1971-30605| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTILEEMDLPGRWKPKIIVGIGGFMKVRQYDQIP
IEICGHKVVGTVLIGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y   K103KN   K43Q, V60I, V118VI, K122E, I135T, T200A, Q207E, R211RK  
>1971-30605| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006