<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1742 1742-30522 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M   L10I, I15V, K20MR, E35D, M36I, N37D, R41RK, D60E, I62V, L63AP, A71T, I72IT, I85IV, Q92QK  
>1742-30522| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYEQVP
IEICGHKTTGTVLVGPTPVNVVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Y115F, Q151M, M184MIV A62V, V75I, F77L, F116Y, K219Q K101KPQT, G190GA   T69N, K122KE, F214FL, D218E  
>1742-30522| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKNSNKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLTKKKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006