<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1076 1076-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69AG_XX, M184I, T215Y A62V, D67DE K101P, K103KN   K43E, K122P, D123E, E138A, I142IV, D177G, R211RK  
>1076-30318| codons 38-247
CTELEEEGKISKIGPENPYNTPVFVIKKKESGKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLPKNKSVTVLDVGDAYFSVPLDPEFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90LM L10F I13V, N37ND, Q61HN, L63P, A71T, I72T, V77VI, P79N, Q92K, I93L  
>1076-30318| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIVGGIGGFVKVRQYDNIP
IEICGHKTTGTVLIGNTPVNVIGRNLMTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006